DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and LOC496623

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001011199.1 Gene:LOC496623 / 496623 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:249 Identity:92/249 - (36%)
Similarity:137/249 - (55%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LACALAGTIP--DGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCL 73
            |.|.|.|...  |      |.:|:||...:.::.||.|||.. |.||||||:.::..|::||||.
 Frog     5 LLCVLLGAAAAFD------DDKIIGGATCAKNSVPYIVSLNS-GYHFCGGSLINNQWVVSAAHCY 62

  Fly    74 QSIEAKDLKIRVGS-TYWRSGGSVHSVRSFR--NHEGYNSRTMVNDIAIIRIESDLSFRSSIREI 135
            ::    .:::|:|. ....|.|:...:.|.:  .|.||||.|:.|||.:|::.|..|..:::..:
 Frog    63 KA----SIQVRLGEHNIALSEGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLSSAASLNAAVNAV 123

  Fly   136 RIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCA-- 198
            .:.......||:.::||||.|.|.||..||.|..:...|:..::|.:   .|..:|.:.|:|.  
 Frog   124 ALPSGCAAAGASCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNN---AYPGEITNNMICLGF 185

  Fly   199 YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERT 252
            ....||:||||||||:|....|.|||||||||....|||||..|.:::.||:.|
 Frog   186 LEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQST 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 83/223 (37%)
Tryp_SPc 31..252 CDD:238113 85/225 (38%)
LOC496623NP_001011199.1 Tryp_SPc 21..239 CDD:238113 85/225 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.