DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and KLK14

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:266 Identity:88/266 - (33%)
Similarity:131/266 - (49%) Gaps:27/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSL-----QRYGSHFCGGSI 60
            |......|.|||.|:..:..|      :.:|:||:..:..:.|:|.:|     :|:   .|||::
Human     1 MFLLLTALQVLAIAMTQSQED------ENKIIGGHTCTRSSQPWQAALLAGPRRRF---LCGGAL 56

  Fly    61 YSHDIVITAAHCLQSIEAKDLKIRVGS---TYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRI 122
            .|...|||||||.:.|    |::.:|.   ..|.:...|..|.....|..|||||..||:.::::
Human    57 LSGQWVITAAHCGRPI----LQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQL 117

  Fly   123 ESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGY 187
            :.......::|.|.:..:....|.:..||||||..|..:..|..|..|::.|.....|:.   .|
Human   118 QQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQK---AY 179

  Fly   188 GKKIKDTMLCAYAPH--KDACQGDSGGPLVSGDRLVGVVSWGY-GCGDVRYPGVYADVAHFHEWI 249
            .:.|...|:||..|.  ||:||||||||||...:|.|:||||. .|....|||||.::..:..||
Human   180 PRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWI 244

  Fly   250 ERTAEE 255
            |.|..:
Human   245 EETMRD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 77/229 (34%)
Tryp_SPc 31..252 CDD:238113 80/231 (35%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.