DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG7829

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:249 Identity:95/249 - (38%)
Similarity:133/249 - (53%) Gaps:14/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAA 70
            :||....|....:.|       |.|||||:...|...||.||:|.||.|.|||||.::..::||.
  Fly    10 LLLQASGCLSLESRP-------DPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAG 67

  Fly    71 HCLQSIEAKDLKIRVGST-YWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIRE 134
            |||..:..:.||::||.| .:|..|.:.||...:.||.:|.:||..||.|||:..:|:....::.
  Fly    68 HCLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKA 132

  Fly   135 IRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCA- 198
            |.|......||..|.::|||.....|.. .|.|....:.|::.:.||:   ..||.:.|.|||| 
  Fly   133 IPINPERVAEGTYATIAGWGFKSMNGPP-SDSLRYARVPIVNQTACRN---LLGKTVTDRMLCAG 193

  Fly   199 -YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIER 251
             .....||||.||||||...::|||:||||.||.....||||:.:...|.|:::
  Fly   194 YLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 89/221 (40%)
Tryp_SPc 31..252 CDD:238113 89/224 (40%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 89/220 (40%)
Tryp_SPc 28..248 CDD:238113 89/224 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452442
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.