DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG34129

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:114/270 - (42%) Gaps:56/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LPQLDG---------------RIVGGYETSIDAHPYQVSLQRY----GSHFCGGSIYSHDIVITA 69
            |||..|               |:.||.:::...: :...|.|.    |:..||.:.|:..:|||:
  Fly    18 LPQSQGTVYPRDILLKTPKFRRVWGGVQSNTGPN-FGGWLLRILNGDGNFACGAAYYAPLLVITS 81

  Fly    70 AHCL----QSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNH---------EGYNSRTMVNDIAIIR 121
            |:|:    .|:|...::           |:..|.....|:         |.:..:.:..|:|::|
  Fly    82 ANCIYPYRNSLEGATVE-----------GTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVR 135

  Fly   122 IESDLSFRSSIRE-IRIADSNPREGATAVVSGWG---TTESGGSTIPDHLLAVDLEIIDVSRCRS 182
            :...:  |..:.| ||:.....:.....||.|||   |.....|:.|.:   |.:.||.:..|| 
  Fly   136 LRDPV--RGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRN---VTVTIISIKECR- 194

  Fly   183 DEFGYGKKIKDTMLCAYAP-HKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFH 246
            .:| ...||..|.:||..| :...|..|.|.||:.|..|.||||:|..|.|...||:|.::....
  Fly   195 QKF-KSPKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVK 258

  Fly   247 EWIERTAEEV 256
            .:|..|.|.:
  Fly   259 RFITETEESI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 64/240 (27%)
Tryp_SPc 31..252 CDD:238113 64/242 (26%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 64/240 (27%)
Tryp_SPc 55..261 CDD:304450 61/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.