DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG10587

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:270 Identity:86/270 - (31%)
Similarity:129/270 - (47%) Gaps:30/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSVLACALAGTIPDGLL------PQLDGRIVGG-YETSIDAHPYQVSLQRYGSHF-CGGSIYSHD 64
            :.|||..|..||....|      |....|:||| ..|:.....|.::| ||..:| |||::....
  Fly    17 IEVLAQDLNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGYLIAL-RYEMNFVCGGTLLHDL 80

  Fly    65 IVITAAHC-LQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSF 128
            ||:||||| |..::..|.....|::.....|....|:.......:....|..|:||:|::..:..
  Fly    81 IVLTAAHCFLGRVKISDWLAVGGASKLNDRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPMKG 145

  Fly   129 RSSIREIRIADSNPREGATAVVSGWGTTESG--GSTIPDHLL-AVDLEIIDVSRCRSD------- 183
            : |:.::.:.......|....|||||.||:.  |   |..|| .|.:.::|..:||:.       
  Fly   146 K-SLGQLILCKKQLMPGTELRVSGWGLTENSEFG---PQKLLRTVTVPVVDKKKCRASYLPTDWE 206

  Fly   184 ---EFGYGKKI--KDTMLCA-YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADV 242
               .|....|:  .|:|.|| ....||||..|||||||..:::.|:||:|.||...||.|||.|:
  Fly   207 SHKHFDLFLKVHLTDSMFCAGVLGKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDI 271

  Fly   243 AHFHEWIERT 252
            .:...:||::
  Fly   272 MYVKPFIEQS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 76/237 (32%)
Tryp_SPc 31..252 CDD:238113 77/239 (32%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 76/237 (32%)
Tryp_SPc 46..280 CDD:238113 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.