DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Sems

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:242 Identity:75/242 - (30%)
Similarity:114/242 - (47%) Gaps:29/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQLDGRIVGG-YETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVG 86
            |.|....|::|| ..|:.....|.|:::.:.:..|||::....||:|||||.:....|:.     
  Fly    36 LPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEA----- 95

  Fly    87 STYWRSGGSV---------HSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNP 142
               |...|.:         ..|:.|.....:...||..|:|::.:...: ...:|..:.:..:..
  Fly    96 ---WSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTAL 156

  Fly   143 REGATAVVSGWGTT---ESGGSTIPDHLL-AVDLEIIDVSRCRSDEFGYGKKIKDTMLCA-YAPH 202
            ..|.|..|||||.|   :.|    |.|:| .|.:.:|:...|| :.:.....|.|:|.|| ....
  Fly   157 TPGQTMDVSGWGMTNPDDEG----PGHMLRTVSVPVIEKRICR-EAYRESVSISDSMFCASVLGK 216

  Fly   203 KDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWI 249
            ||||..|||||||...::.|:||:|.||...||||||.||.:...:|
  Fly   217 KDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 72/233 (31%)
Tryp_SPc 31..252 CDD:238113 72/234 (31%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 72/233 (31%)
Tryp_SPc 44..265 CDD:238113 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.