DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG32374

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:231 Identity:74/231 - (32%)
Similarity:123/231 - (53%) Gaps:4/231 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGYETSIDAHPYQVSLQRYGSHF-CGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYW 90
            |..|||.|.:......|||.:| .|.::| ||..|.:...::||.||......: ..:|.|||..
  Fly    70 LPTRIVNGKKIKCSRAPYQCAL-HYNNYFICGCVILNRRWILTAQHCKIGNPGR-YTVRAGSTQQ 132

  Fly    91 RSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREGATA-VVSGWG 154
            |.||.:..|:....|..|:..||.||:.::::::.|:....::::::..:..:..... :.||||
  Fly   133 RRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWG 197

  Fly   155 TTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAPHKDACQGDSGGPLVSGDR 219
            .|.:....:..:|..|.:..:..::|:.|..|.|.||...|:||...::|.|.||||||||....
  Fly   198 LTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLVHNGV 262

  Fly   220 LVGVVSWGYGCGDVRYPGVYADVAHFHEWIERTAEE 255
            |.|:.|:|.||...:|||||.:|..:..||::.|::
  Fly   263 LYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVAKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 70/220 (32%)
Tryp_SPc 31..252 CDD:238113 71/222 (32%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 70/220 (32%)
Tryp_SPc 74..295 CDD:238113 71/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452440
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.