DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG16998

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:252 Identity:77/252 - (30%)
Similarity:131/252 - (51%) Gaps:11/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAH 71
            :|:::...:.|.....|.||  .|||||.|..|...|:..|:..:|::.|..::.:...::||.|
  Fly     3 ILALILLLICGHKTSALSPQ--ERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGH 65

  Fly    72 CLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIR 136
            |:|..::  ..:|.|||:...||...:|.|...|..:|.||:.||||:::::...:...:|:.::
  Fly    66 CVQYPDS--YSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVK 128

  Fly   137 I----ADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLC 197
            :    .:..||   |.:|:|||..::..|.....|....:::|:...|:.......:.|.|.|:|
  Fly   129 LPLPSLNILPR---TLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVC 190

  Fly   198 AYAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERTAE 254
            |....:|.|.||||.|||......|:||:.:||.|..:||||..:|::..||....|
  Fly   191 AAGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 69/222 (31%)
Tryp_SPc 31..252 CDD:238113 70/224 (31%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 69/222 (31%)
Tryp_SPc 25..242 CDD:238113 68/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.