DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG13430

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:264 Identity:104/264 - (39%)
Similarity:150/264 - (56%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVI 67
            :.||.|.::..:.|....|   .:.|||||||:||.|...|:|||||....|.|||:|.|.:|::
  Fly     7 RLAVALWLICTSAAQNSTD---VEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIIL 68

  Fly    68 TAAHC-LQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRT-MVNDIAIIRIESDLSFRS 130
            ||||| |:..:.:...||.||:.|..|||...|:....|..::..| |.|||||::::..|.:..
  Fly    69 TAAHCVLEYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQ 133

  Fly   131 SIREIRIADSNPREGATA--VVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKD 193
            .||.|.:|.|......||  .|||||:|..........|....:.:.|.::|..:.||.| .:.:
  Fly   134 DIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAG-TVTN 197

  Fly   194 TMLCA--YAPHKDACQGDSGGPLVSGD----RLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERT 252
            ||.||  .|..:|:||||||||||:..    :|.|:||||:||.:..:||:|..|:.:.:||.:|
  Fly   198 TMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQT 262

  Fly   253 AEEV 256
            .||:
  Fly   263 IEEL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 92/228 (40%)
Tryp_SPc 31..252 CDD:238113 93/230 (40%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 92/228 (40%)
Tryp_SPc 32..262 CDD:238113 93/230 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452462
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.