DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG9897

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:279 Identity:76/279 - (27%)
Similarity:129/279 - (46%) Gaps:38/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQL---DGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYS 62
            ||...:||.::|           ||.|   |.||:.|...:|...|:..|:.......|||:|.|
  Fly     1 MLAPLILLQIVA-----------LPWLALGDQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIIS 54

  Fly    63 HDIVITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLS 127
            .:.::|||.|:....|:.:::|:|::...:.||:..:...:.|..|:|....|::|:::....|:
  Fly    55 KNYILTAAKCVDGYSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLN 119

  Fly   128 FRSSIREIRIADSNPREGATAVVSGWGTTE------------SGG-----STIPDHLLAVDLEII 175
            ....|:.|..||..|.:.:.|.|:|.|...            |.|     ..:|..|....:.|:
  Fly   120 TTDEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRIL 184

  Fly   176 DVSRCRSD----EFGYGKKIKDTMLCAYAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYP 236
            ...:|.:|    .|...|.|.|..:|..:|.|.||..|.|.|||..::|||::|.. || .:: |
  Fly   185 SQKQCAADWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVIDNKLVGILSRA-GC-SIK-P 246

  Fly   237 GVYADVAHFHEWIERTAEE 255
            .|||::.....|::...::
  Fly   247 DVYANILGHTNWLDSNTKD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 66/239 (28%)
Tryp_SPc 31..252 CDD:238113 66/241 (27%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.