DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG11192

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:260 Identity:101/260 - (38%)
Similarity:147/260 - (56%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAH 71
            |::::|.|.|...|.      |||||||...:|...|||||:|..|.|.|||:|...|.|:||||
  Fly    10 LMALVAYAGATPTPG------DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAH 68

  Fly    72 CLQS-IEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREI 135
            |.:. ..:.|..:||||:...|||.|.|:|....|..||.::..||:|::.:...|:|...::.:
  Fly    69 CFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPV 133

  Fly   136 RIAD-SNPREGATAV-VSGWG-----TTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKD 193
            .:|. ::|....|.: |||||     :..||...:...|..||:::::.::||.   .|.:.:..
  Fly   134 PLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRR---AYSQVLPI 195

  Fly   194 T--MLCAYAPHKDACQGDSGGPLV------SGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIE 250
            |  |:||..|.:|:||||||||||      ...||.|:||||.||.:..:||||.:||.|..||:
  Fly   196 TRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWID 260

  Fly   251  250
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 92/234 (39%)
Tryp_SPc 31..252 CDD:238113 93/236 (39%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 92/234 (39%)
Tryp_SPc 28..262 CDD:238113 93/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452461
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.