DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and iotaTry

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:257 Identity:108/257 - (42%)
Similarity:153/257 - (59%) Gaps:6/257 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDI 65
            |..:.::.:||...|.|...|   .:..|||:||.:..|...|:|||:|....|.|||.|||.:|
  Fly     1 MAVYGIVATVLVLLLLGDASD---VEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEI 62

  Fly    66 VITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRS 130
            :|||.|||.......:|:|||:.....||::..|.:::.||.::||.:..|||::|:.:.|:|..
  Fly    63 IITAGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGL 127

  Fly   131 SIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKK-IKDT 194
            |.|.|.:|.::|..|.|..|:|||.|::|  .:.|.|....|:|||...|.|.:||||.. :.:.
  Fly   128 STRAINLASTSPSGGTTVTVTGWGHTDNG--ALSDSLQKAQLQIIDRGECASQKFGYGADFVGEE 190

  Fly   195 MLCAYAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERTAEEV 256
            .:||.:...|||.||||||||:..:|||:|||||.|.|..|||||||||....||.:.|..:
  Fly   191 TICAASTDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKAANAI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 98/219 (45%)
Tryp_SPc 31..252 CDD:238113 99/221 (45%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 98/219 (45%)
Tryp_SPc 28..247 CDD:238113 99/220 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452458
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm49678
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.900

Return to query results.
Submit another query.