DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Try29F

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:234 Identity:93/234 - (39%)
Similarity:132/234 - (56%) Gaps:17/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTY 89
            |:||||||||...:|...|||||||| ..||||||:.:...|:|||||.:.......|:|:||:.
  Fly    36 PRLDGRIVGGQVANIKDIPYQVSLQR-SYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSR 99

  Fly    90 WRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIA-------DSNPREGAT 147
            ...||.:..::....|..:::.|:..|.:::.:|     ..|.:.:..|       |::..:|..
  Fly   100 TSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELE-----EYSAKNVTQAFVGLPEQDADIADGTP 159

  Fly   148 AVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAPH--KDACQGDS 210
            .:|||||.|:|...| ...|.:|.:..:..::| ::.:|....|.|.||||..|.  ||||||||
  Fly   160 VLVSGWGNTQSAQET-SAVLRSVTVPKVSQTQC-TEAYGNFGSITDRMLCAGLPEGGKDACQGDS 222

  Fly   211 GGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWI 249
            ||||.:...|.|||||||||....|||||:.|:...:||
  Fly   223 GGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 87/227 (38%)
Tryp_SPc 31..252 CDD:238113 88/228 (39%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 87/227 (38%)
Tryp_SPc 42..264 CDD:238113 88/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452439
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.