DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG31954

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:272 Identity:97/272 - (35%)
Similarity:145/272 - (53%) Gaps:26/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACALAGTI------------------PDGLLPQLDGRIVGGYETSIDAHPYQVSL 48
            |:..|||......|||..                  |..|.|:||||||||:..:|...|:||||
  Fly     4 LRLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSL 68

  Fly    49 QRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTM 113
            |. .||.|||||.|.:.::|||||.....|..||:|:|::.:...|.:..|:....|..:|...:
  Fly    69 QT-SSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNV 132

  Fly   114 VNDIAIIRIESDLSFRSSIREIRIADSNPR--EGATAVVSGWGTTESGGSTIPDHLLAVDLEIID 176
            ..|.:::::...:.|..:.:.:::.:|..:  :|....|||||.|::...: .:.|..|::.:::
  Fly   133 DYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLES-REWLRQVEVPLVN 196

  Fly   177 VSRCRSDEFGYGKKIKDTMLCA--YAPHKDACQGDSGGPLVS-GDRLVGVVSWGYGCGDVRYPGV 238
            ...|......|| .:.:.|:||  ....|||||||||||:|| ...|||||||||||....||||
  Fly   197 QELCSEKYKQYG-GVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGV 260

  Fly   239 YADVAHFHEWIE 250
            |:.|:...:||:
  Fly   261 YSRVSFARDWIK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 82/223 (37%)
Tryp_SPc 31..252 CDD:238113 83/225 (37%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 82/223 (37%)
Tryp_SPc 51..274 CDD:238113 83/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.