DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG4271

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:227 Identity:73/227 - (32%)
Similarity:112/227 - (49%) Gaps:8/227 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRSGGS 95
            |..|.|...|...:..|:...|.|.|||::....||:|||.|:::...|.:.:|||:.....||.
  Fly    19 IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGR 83

  Fly    96 VHSVRSFRNHEGYNSRTMVNDIAIIRIESD-LSFRSSIREIRIADSNPREGATAVVSGWGTTESG 159
            :..|.:...||.|  :...||||::.:|.. ||.|  :.:|.:|...|.|......:|||.....
  Fly    84 IIRVTALVVHENY--KNWDNDIALLWLEKPVLSVR--VTKIPLATKEPSENEYPSNAGWGEKLLE 144

  Fly   160 GSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAPHKDACQGDSGGPLVSGDRLVGVV 224
            ...:...|.....:|...|.|..:   ..:.:.:.:|||:....|.|.||.|||||..:::||:.
  Fly   145 SYVVTRKLQNGVTKIRPRSMCAEE---LVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIA 206

  Fly   225 SWGYGCGDVRYPGVYADVAHFHEWIERTAEEV 256
            ..|:|||....|.:|.:|.|:.||||..||::
  Fly   207 VQGHGCGFAVLPSLYTNVFHYLEWIEENAEKL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 68/218 (31%)
Tryp_SPc 31..252 CDD:238113 71/221 (32%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 71/221 (32%)
Tryp_SPc 19..231 CDD:214473 68/218 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.