DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG4653

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:123/260 - (47%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAH 71
            ||.::.....|.:....||           ..:.:.|:.:||:|.|.|.|||::.....::||||
  Fly    12 LLLLVVIVTLGVVQSSRLP-----------AEVGSQPHSISLRRNGVHVCGGALIREKWILTAAH 65

  Fly    72 CL------QSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMV--NDIAIIRIESDLSF 128
            |:      ||..||...:||||....:||.:..:.....|..|:|...|  ||:|::.:|:.:..
  Fly    66 CVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVL 130

  Fly   129 RSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAV-DLEIIDVSRCRSDEFGYGKKIK 192
            .::...|.:|...|..|:..:.||||:::..||.  .|:|.| ..:.:..|.|:::.:    ..:
  Fly   131 NANTNPIDLATERPAAGSQIIFSGWGSSQVDGSL--SHVLQVATRQSLSASDCQTELY----LQQ 189

  Fly   193 DTMLCAYAPHKD---ACQGDSGGPLVSGDRLVGVVSWGY-GCGDVRYPGVYADVAHFHEWIERTA 253
            :.:||.....:|   .|.||:|.|....::|||:.::.. |||. ..|..|.||....|||...|
  Fly   190 EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGS-EQPDGYVDVTQHLEWINENA 253

  Fly   254  253
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 66/231 (29%)
Tryp_SPc 31..252 CDD:238113 68/233 (29%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/239 (29%)
Tryp_SPc 30..249 CDD:214473 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.