DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG33159

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:253 Identity:85/253 - (33%)
Similarity:131/253 - (51%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIE 77
            |.||..:|..   ....|||||.||:|...||.|.|::.|...||||:.|...|::||||:...:
  Fly    11 CHLALVLPSS---SSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQ 72

  Fly    78 AKDLKIRVG-STYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFR----SSIREIRI 137
            .:...:..| |...:....|.:|..|.....|::.....|:|:::::..:...    ::|...| 
  Fly    73 PEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCR- 136

  Fly   138 ADSNPREG-ATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAP 201
               ||.|| |.|.:||||.|........:.:....:.::..:.|:....||| ::.|:||||...
  Fly   137 ---NPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYG-QLSDSMLCAAVR 197

  Fly   202 H-KDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVA--HFHEWIERTAEEV 256
            . :|:|.||||||||...::.|:||||:||....:||||.:||  ..||:||:|...:
  Fly   198 GLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLRRI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 78/227 (34%)
Tryp_SPc 31..252 CDD:238113 79/229 (34%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 75/220 (34%)
Tryp_SPc 26..251 CDD:238113 79/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.