DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG31267

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:233 Identity:85/233 - (36%)
Similarity:125/233 - (53%) Gaps:10/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGYETSIDAHPYQVSLQR-YGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTY 89
            :...|||||.|:.:.|.||.||||. ||:|||.|||.....|||||.||..:...:::: |.:||
  Fly    40 KFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQV-VTTTY 103

  Fly    90 --WRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIAD-SNPREGATAVVS 151
              |.|.|.::||.....|..::|....||||:|:..:...:....:.|.||. .:..:|.|..:.
  Fly   104 NHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMY 168

  Fly   152 GWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAP-HKDACQGDSGGPLV 215
            |:|:||.||. ....|..:|:..:...:|.: .:|....:....|||... ...||.||:|||:|
  Fly   169 GYGSTEIGGD-FSWQLQQLDVTYVAPEKCNA-TYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIV 231

  Fly   216 -SGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERT 252
             |..|||||.:||..|| ..:|.|:|.::.::.||..|
  Fly   232 DSRGRLVGVGNWGVPCG-YGFPDVFARISFYYSWIIST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 82/224 (37%)
Tryp_SPc 31..252 CDD:238113 83/226 (37%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 82/224 (37%)
Tryp_SPc 45..268 CDD:238113 83/226 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.