DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG32834

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:265 Identity:84/265 - (31%)
Similarity:130/265 - (49%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVIT 68
            |..||:.|...:.|.:      ....||:|||:..|:..|||..:...|:..|.|:|.:.|.:||
  Fly     6 FLFLLAALLRPVRGDL------DAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIIT 64

  Fly    69 AAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIR 133
            ||.|:||..:.::::...|..:...|.:..|....||..||.....|::|::::...|....:|:
  Fly    65 AASCVQSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQ 129

  Fly   134 EIRIADSNPREGATAVVSGWGTTESGGS-------TIPDHLLAVDLEIIDVSRCRSDE---FG-Y 187
            .|.||:..|.:|:...|||||:|...||       ::||:|....:.:.:..:|.:|.   || :
  Fly   130 PISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLW 194

  Fly   188 GKKIKDTMLCAYAPHKDA--CQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIE 250
            ...|....||.   |..|  |..|:|.|||...:|||::|.| ||  ...|.|||:|..|..||.
  Fly   195 DNGISYLTLCT---HNGAGGCSYDTGAPLVIDGQLVGILSEG-GC--TTKPDVYANVPWFTGWIA 253

  Fly   251 RTAEE 255
            ...|:
  Fly   254 ENTED 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 76/231 (33%)
Tryp_SPc 31..252 CDD:238113 77/233 (33%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 76/231 (33%)
Tryp_SPc 27..255 CDD:238113 77/233 (33%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.