DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG32755

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:257 Identity:92/257 - (35%)
Similarity:129/257 - (50%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PDGLLPQLDGRIVGGYETSIDAHPYQVSLQR-------YG-SHFCGGSIYSHDIVITAAHCLQSI 76
            |..:||    :|||||..:||..|:|||::|       || .|.|||::.|..:|.:||||....
  Fly    31 PFVILP----KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAIN 91

  Fly    77 EAKDLKIRVGSTYWRSGGS-----------VHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRS 130
            .:..|..|....|....||           .:.|:....|:.||..|:.||||::.:...:.:.|
  Fly    92 TSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWES 156

  Fly   131 -SIREIRIADSNPREGATAVVSGWGTT---ESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKI 191
             .:|.|.:|...|.||.|.::.|||..   |...|     |....:.|::...|   :..|  |:
  Fly   157 PGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS-----LQQAPVPILNKELC---QVIY--KL 211

  Fly   192 KDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIER 251
            ..:.:||  .....|||||||||||:...||.|::|||.||.|..|||||.:|:||.:||.|
  Fly   212 PASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 86/243 (35%)
Tryp_SPc 31..252 CDD:238113 89/246 (36%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 86/243 (35%)
Tryp_SPc 38..273 CDD:238113 88/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.