DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG32523

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:234 Identity:79/234 - (33%)
Similarity:119/234 - (50%) Gaps:13/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQ---SIEAKDL-KIRVGS 87
            ::.|||||.:......|:|:||:..|.|:|||.|.|...||||.||::   .:...|| .|:.||
  Fly    33 IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97

  Fly    88 TYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREGATAVVSG 152
            ....|.|....|.....|..|.:... ||:|::|::|.|:|.::|..|::|..:|.......:||
  Fly    98 LLLSSDGVRIPVAEVIMHPNYATGGH-NDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISG 161

  Fly   153 WGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLC-AYAPHKDACQGDSGGPLVS 216
            ||.....| .:.|.||.|.:..|....||   :.:..::.:||:| .::.:..||.||||||...
  Fly   162 WGNIAEKG-PLSDSLLFVQVTSISRGACR---WMFYSRLPETMICLLHSKNSGACYGDSGGPATY 222

  Fly   217 GDRLVGVVS--WGYGCGDVRYPGVYADVAHFHEWIERTA 253
            |.::||:.|  .|.|||... |..|..::....||...|
  Fly   223 GGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWIAEKA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 76/225 (34%)
Tryp_SPc 31..252 CDD:238113 77/227 (34%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 76/225 (34%)
Tryp_SPc 37..219 CDD:238113 63/186 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.