DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG32376

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:226 Identity:79/226 - (34%)
Similarity:117/226 - (51%) Gaps:8/226 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRSGG 94
            |||.|........|:|.||...|...||..|.:...::||.||......| ..:||||...|.||
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEK-YTVRVGSDQQRRGG 128

  Fly    95 SVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSN----PREGATAVVSGWGT 155
            .:..|:.......||..||.:|:|:::::|.:.|...:|.:::..:.    |::   .||||||.
  Fly   129 QLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKK---FVVSGWGI 190

  Fly   156 TESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAPHKDACQGDSGGPLVSGDRL 220
            |.:....:..:|..|.::.|..|:|:......|.||...|:||...:||:|.|||||||.|...|
  Fly   191 TSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNKDSCSGDSGGPLTSRGVL 255

  Fly   221 VGVVSWGYGCGDVRYPGVYADVAHFHEWIER 251
            .|:||||.||.:..|||||.:...:..||::
  Fly   256 YGIVSWGIGCANKNYPGVYVNCKRYVPWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 77/222 (35%)
Tryp_SPc 31..252 CDD:238113 78/225 (35%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 77/222 (35%)
Tryp_SPc 66..287 CDD:238113 78/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
43.910

Return to query results.
Submit another query.