DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Klk14

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:262 Identity:92/262 - (35%)
Similarity:133/262 - (50%) Gaps:22/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSH--FCGGSIYSH 63
            |....::|..||.|:|.:       |.|.:|:|||....::.|:||:||....|  .|||.:.|.
Mouse     1 MFLLLIILQALAVAIAQS-------QGDHKIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSD 58

  Fly    64 DIVITAAHCLQSIEAKDLKIRVGS---TYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESD 125
            ..|||||||.:.|    |.:.:|.   ..|.:...|..|.....|..|..:...||:.:::::..
Mouse    59 QWVITAAHCARPI----LHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKK 119

  Fly   126 LSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKK 190
            :....:::.|.:|.|....|....||||||..|..:..|..|..|::.|:....|..   .|...
Mouse   120 VRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHR---AYPGI 181

  Fly   191 IKDTMLCAYAPH--KDACQGDSGGPLVSGDRLVGVVSWGY-GCGDVRYPGVYADVAHFHEWIERT 252
            |...|:||..|.  ||:||||||||||.|.:|.|:||||. .|....||||||::.::|.||:||
Mouse   182 ITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRT 246

  Fly   253 AE 254
            .:
Mouse   247 MQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 80/226 (35%)
Tryp_SPc 31..252 CDD:238113 82/228 (36%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 82/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.