DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Klk15

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:265 Identity:84/265 - (31%)
Similarity:125/265 - (47%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDI 65
            :|.|.:|:|        ...||      .:::.|.|....:.|:||:|...|...||..:.|...
Mouse     4 LLAFVLLVS--------AAQDG------DKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRW 54

  Fly    66 VITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRN---HEGYNSRTMVNDIAIIRIESDLS 127
            |:|||||    :.:.:::|:|....|.......:||...   |.||.:||..:||.::|:.....
Mouse    55 VLTAAHC----QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPAR 115

  Fly   128 FRSSIREIRIADSNPREGATAVVSGWG--TTESGGST--------IPDHLLAVDLEIIDVSRCRS 182
            ..:.:|.:.:....|..|...||||||  :..:.|:|        :||.|...::.||..:.|..
Mouse   116 LTAYVRPVALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCNK 180

  Fly   183 DEFGYGKKIKDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWG-YGCGDVRYPGVYADVAH 244
            |   |..::..||:||  .....|:|:||||||||.|..|.|:|||| ..|.....||||..|..
Mouse   181 D---YPGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCS 242

  Fly   245 FHEWI 249
            :.|||
Mouse   243 YLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 76/234 (32%)
Tryp_SPc 31..252 CDD:238113 78/235 (33%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.