DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG6041

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:272 Identity:86/272 - (31%)
Similarity:137/272 - (50%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLSVLACAL-AGTIPDG------LLPQLDGRIVGGYETSIDAHPYQVSL-------QRYGS-H 54
            |.:.::||.|| .|.:..|      ...:::.:|||||:.||:...||||:       :.||| |
  Fly     2 AKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGH 66

  Fly    55 FCGGSIYSHDIVITAAHCLQSIEAK------DLKIRVGSTYWRSGGS---VHSVRSFRNHEGYNS 110
            .|||.:.|..:|.|||||....:.|      :..:.:||||..|...   ::.::....||.||.
  Fly    67 LCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNP 131

  Fly   111 RTMVNDIAIIRIESDLSFR-SSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEI 174
            ..:.||||::.|...:.:. .::..:.:...........::||||..:..|:...:.|.|..:.|
  Fly   132 DALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPI 196

  Fly   175 IDVSRCRSDEFGYGKKIKDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPG 237
            :..:.||   ..| ..|..:.:||  .:...||||||||||:.....|.|:||:|.||....|||
  Fly   197 VSYTTCR---ISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPG 257

  Fly   238 VYADVAHFHEWI 249
            ||.:|:::::||
  Fly   258 VYTNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 77/238 (32%)
Tryp_SPc 31..252 CDD:238113 79/239 (33%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 77/238 (32%)
Tryp_SPc 35..272 CDD:238113 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.