DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prtn3

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:270 Identity:77/270 - (28%)
Similarity:121/270 - (44%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LAC-ALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQ---RYGSHFCGGSIYSHDIVITAAH 71
            |.| .|||....|.:..  .:||||:|....:.||..|||   ..|||||||::.....|:||||
  Rat   179 LPCLRLAGVRFHGAVQA--SKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAH 241

  Fly    72 CLQSIEAKDLKIRVGSTYWRSGGSVHSVRS-------------FRNHEGYNSRTMVNDIAIIRIE 123
            |||.|..:.:.:.:|:         |.:.|             |.|:  ||....:||:.::::.
  Rat   242 CLQDISWQLVTVVLGA---------HDLLSSEPEQQKFTITQVFENN--YNPEETLNDVLLLQLN 295

  Fly   124 --SDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVS-RCRSDEF 185
              :.|..:.::..:...|.:..:|...:..|||..   |:..|...:..:|.:..|: .||... 
  Rat   296 RPASLGKQVAVASLPQQDQSLSQGTQCLAMGWGRL---GTRAPTPRVLHELNVTVVTFLCREHN- 356

  Fly   186 GYGKKIKDTMLCAYAPHKDA--CQGDSGGPLVSGDRLVGVVSWGY-GCGDVRYPGVYADVAHFHE 247
                      :|...|.:.|  |.|||||||:....|.||.|:.. .|..:::|..:|.|:.:..
  Rat   357 ----------VCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVN 411

  Fly   248 WIE---RTAE 254
            ||.   |:||
  Rat   412 WIHSVLRSAE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 66/240 (28%)
Tryp_SPc 31..252 CDD:238113 68/245 (28%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.