DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and LOC312273

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:268 Identity:86/268 - (32%)
Similarity:125/268 - (46%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIV 66
            :|..:..::|....|....|.     |.||||||.....:.||||||.. |||.||||:.:...|
  Rat     1 MKICIFFTLLGTVAAFPTEDN-----DDRIVGGYTCQEHSVPYQVSLNA-GSHICGGSLITDQWV 59

  Fly    67 ITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRN------------HEGYNSRTMVNDIAI 119
            ::||||..    ..|::|:|.         |::.....            |..|:..|:.|||.:
  Rat    60 LSAAHCYH----PQLQVRLGE---------HNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIML 111

  Fly   120 IRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDE 184
            |:::|..:..|.:..|.:....|..|...:|||||..:.|..: |..|..:|..::..|.|..  
  Rat   112 IKLKSPATLNSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFES-PSVLQCLDAPVLSDSVCHK-- 173

  Fly   185 FGYGKKIKDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHE 247
             .|.::|.:.|.|.  ....||:||.|||||:|....:.|:||||.||.....||||..|.::..
  Rat   174 -AYPRQITNNMFCLGFLEGGKDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLN 237

  Fly   248 WIERTAEE 255
            ||.:|..|
  Rat   238 WIHQTIAE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 77/232 (33%)
Tryp_SPc 31..252 CDD:238113 78/234 (33%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.