DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Klk8

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:267 Identity:84/267 - (31%)
Similarity:128/267 - (47%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLSVLACALAGTIPDGLLPQLDG-RIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITA 69
            :||.:|..|.||      |.:..| :|:.|.|....:.|:|.:|.:.....|||.:.....|:||
  Rat    13 ILLFLLMGAWAG------LTRAQGSKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTA 71

  Fly    70 AHCLQSIEAKD-LKIRVGSTYWRSGGSVHSV-------------RSFRNHEGYNS---RTMVNDI 117
            |||     .|| ..:|:|.         ||:             ||.: |..:||   ....:||
  Rat    72 AHC-----KKDKYSVRLGD---------HSLQKRDEPEQEIQVARSIQ-HPCFNSSNPEDHSHDI 121

  Fly   118 AIIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRS 182
            .:||:::..:....::.|.:|:..|:.|...::|||||..|.....|:.|...:::|...::|  
  Rat   122 MLIRLQNSANLGDKVKPIELANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKC-- 184

  Fly   183 DEFGYGKKIKDTMLCAYAPH-KDACQGDSGGPLVSGDRLVGVVSWGYG-CGDVRYPGVYADVAHF 245
             |..|..||.:.|:||.:.: .|.||||||||||....|.|:.|||.. ||....||||..:..:
  Rat   185 -ERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCNGVLQGITSWGSDPCGKPEKPGVYTKICRY 248

  Fly   246 HEWIERT 252
            ..||::|
  Rat   249 TNWIKKT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 73/237 (31%)
Tryp_SPc 31..252 CDD:238113 75/239 (31%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.