DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Klk12

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:264 Identity:89/264 - (33%)
Similarity:131/264 - (49%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACALAGTIPDGLLPQLD-GRIVGGYETSIDAHPYQVSLQRYGSHF-CGGSIYSHD 64
            :|..:||  |.|.:.       |.|.| .:|..|.|...::.|:||.| .:|.:. |||.:....
  Rat     1 MKLNILL--LLCVVG-------LSQADREKIYNGVECVKNSQPWQVGL-FHGKYLRCGGVLVDRK 55

  Fly    65 IVITAAHCL---------QSIEAKDL--KIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIA 118
            .|:|||||.         .|:...||  ::|: :|:..:..|.|.  :::|||        :|:.
  Rat    56 WVLTAAHCSGKYMVRLGEHSLSKLDLTEQLRL-TTFSITHPSYHG--AYQNHE--------HDLR 109

  Fly   119 IIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSD 183
            ::|:...:|...::|.:.:..|....||...:||||||.......||.|..:||.|:....||: 
  Rat   110 LLRLNRPISLTYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRA- 173

  Fly   184 EFGYGKKIKDTMLCAYA-PHKDACQGDSGGPLVSGDRLVGVVSWGY--GCGDVRYPGVYADVAHF 245
              .:..::.:.||||.. ..|||||||||||||.|..|.|:||||.  .||....||||..|..:
  Rat   174 --VFPGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKY 236

  Fly   246 HEWI 249
            .:||
  Rat   237 TDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 79/233 (34%)
Tryp_SPc 31..252 CDD:238113 81/234 (35%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.