DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Tpsg1

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:265 Identity:91/265 - (34%)
Similarity:135/265 - (50%) Gaps:31/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLLSVLACALAGTIPDGLLPQLD---GRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDI 65
            |.:||:|..|.         .||:.   .|||||:.....|.|:|.||:....|.||||:.|.:.
  Rat     9 FLLLLAVPGCG---------QPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEW 64

  Fly    66 VITAAHCLQ-SIEAKDLKIRVGS---TYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDL 126
            |:|||||.. |:.:.|.::.:|.   |......:|..:..:.:..|....:  .|||::::.:.:
  Rat    65 VLTAAHCFSGSVNSSDYEVHLGELTITLSPHFSTVKQIIMYSSAPGPPGSS--GDIALVQLATPV 127

  Fly   127 SFRSSIREIRI----ADSNPREGATAVVSGWGTTESGGSTIPDH-LLAVDLEIIDVSRC-RSDEF 185
            :..|.::.:.:    ||.:|  |....|:|||.|:.|....|.: |....:.::||..| ::...
  Rat   128 ALSSQVQPVCLPEASADFHP--GMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSS 190

  Fly   186 GYGKKIKDTMLCAYAPHKDACQGDSGGPL---VSGD-RLVGVVSWGYGCGDVRYPGVYADVAHFH 246
            ..|..|:..||||:.| .||||.||||||   |:|. :..||||||.|||....|||||.|..:.
  Rat   191 SNGSLIQSDMLCAWGP-GDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYARVTAYV 254

  Fly   247 EWIER 251
            .||.|
  Rat   255 NWIHR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 81/232 (35%)
Tryp_SPc 31..252 CDD:238113 83/235 (35%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 81/232 (35%)
Tryp_SPc 30..260 CDD:238113 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.