DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Elane

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:264 Identity:79/264 - (29%)
Similarity:124/264 - (46%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAA 70
            :|..:|.|           |.|...||||......|.|:.|||||.|.||||.::.:.:.|::||
  Rat    19 LLALLLVC-----------PALASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAA 72

  Fly    71 HCL-----QSIE----AKDLKIRVGSTYWRSGGSVHSV-RSFRNHEGYNSRTMVNDIAIIRIESD 125
            ||:     ||::    |.||:.|..:.      .:.|| |.|.|  |::...::|||.||::...
  Rat    73 HCVNGRNFQSVQVVLGAHDLRRREPTR------QIFSVQRIFEN--GFDPSRLLNDIVIIQLNGS 129

  Fly   126 LSFRSSIREIRIADSNPREG------ATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDE 184
            .:..::::...:    |.:|      ...|..|||...: ...:|..|..:::.:: .:.||   
  Rat   130 ATINANVQVAEL----PAQGQGVGNRTPCVAMGWGRLGT-NRPLPSVLQELNVTVV-TNLCR--- 185

  Fly   185 FGYGKKIKDTMLCAYAPHKDA--CQGDSGGPLVSGDRLVGVVSW--GYGCGDVRYPGVYADVAHF 245
                   :...:|...|.:.|  |.||||||||..:.:.|:.|:  | |||...||..:|.||.|
  Rat   186 -------RRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVAEF 242

  Fly   246 HEWI 249
            .:||
  Rat   243 ADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 72/238 (30%)
Tryp_SPc 31..252 CDD:238113 74/239 (31%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 72/238 (30%)
Tryp_SPc 33..249 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.