DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Klk1c3

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:271 Identity:80/271 - (29%)
Similarity:128/271 - (47%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVIT 68
            |.:|...|:.......|.|     ..|:|||::...::.|:||::  .....|||.:.....|||
  Rat     3 FLILFLALSLGQIDAAPPG-----QSRVVGGFKCEKNSQPWQVAV--INEDLCGGVLIDPSWVIT 60

  Fly    69 AAHCL---------QSIEAKDLKIRVGSTYWRSGGSVH-SVRSF--RNH----EGYNSRTMVNDI 117
            ||||.         |:..::|::.|:.|..:|     | ..:.|  |||    :.|:     ||:
  Rat    61 AAHCYSDNYHVLLGQNNLSEDVQHRLVSQSFR-----HPDYKPFLMRNHTRKPKDYS-----NDL 115

  Fly   118 AIIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRS 182
            .::.:.........::.|.:....|:.|:|.:|||||:|.......||.|..|::.::...:|..
  Rat   116 MLLHLSEPADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIK 180

  Fly   183 DEFGYGKKIKDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWG-YGCGDVRYPGVYADVAH 244
               .|.:|:.|.||||  ....||.|:|||||||:....|.|:.||| ..||:...||:|..:..
  Rat   181 ---AYKEKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIK 242

  Fly   245 FHEWIERTAEE 255
            |..||:...::
  Rat   243 FTSWIKEVMKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 73/237 (31%)
Tryp_SPc 31..252 CDD:238113 74/239 (31%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 73/237 (31%)
Tryp_SPc 25..250 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.