DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Klk9

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:262 Identity:81/262 - (30%)
Similarity:121/262 - (46%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLSVLA--CALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVIT 68
            ||.|:||  |.            .|.|.||..|...::.|:|..|.......||.::.:...::|
  Rat     8 VLFSLLAGHCG------------ADTRAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLT 60

  Fly    69 AAHCLQSIEAKDLKIRVGSTY---WRSGGSVHSVRSFRNHEGYNSRTMVN----DIAIIRIESDL 126
            ||||.:..    |.:|:|..:   |.....:..|..|..|.|:|.....|    ||.:||:...:
  Rat    61 AAHCRKPY----LWVRLGEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKV 121

  Fly   127 SFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKI 191
            ....:::.:.::.|.|..|...::||||:..|.....|..|...::.|:|...||   :.|...|
  Rat   122 RLSPAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCR---WAYPGHI 183

  Fly   192 KDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWG-YGCGDVRYPGVYADVAHFHEWIERTA 253
            .:.||||  :...:.:||||||||||....|.|:||.| ..|...:.|.||..|.|:.:|||.|.
  Rat   184 SEKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWIENTV 248

  Fly   254 EE 255
            |:
  Rat   249 EK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 69/228 (30%)
Tryp_SPc 31..252 CDD:238113 71/230 (31%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 71/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.