DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Klk11

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:266 Identity:84/266 - (31%)
Similarity:127/266 - (47%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDI 65
            :|:..::|..:|.||......|     :.||:.|||....:.|:||:|.:.....||.::.:...
  Rat    26 LLQAMMILRFIALALVTGHVGG-----ETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKW 85

  Fly    66 VITAAHCLQ----------SIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYN----SRTMVND 116
            ::|||||.:          ::|..|     |....|.     :..|| .|.|:|    ::...||
  Rat    86 LLTAAHCRKPHYVILLGEHNLEKTD-----GCEQRRM-----ATESF-PHPGFNNSLPNKDHRND 139

  Fly   117 IAIIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCR 181
            |.::::.|......::|.:.::......|.:.::||||||.|....:|..|...::.||....| 
  Rat   140 IMLVKMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKEC- 203

  Fly   182 SDEFGYGKKIKDTMLCAYA--PHKDACQGDSGGPLVSGDRLVGVVSWGYG-CGDVRYPGVYADVA 243
              |..|...|.||||||..  ..||:||||||||||....|.|::|||.. |...|.||||..|.
  Rat   204 --ERAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVC 266

  Fly   244 HFHEWI 249
            .:.:||
  Rat   267 KYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 76/235 (32%)
Tryp_SPc 31..252 CDD:238113 77/236 (33%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 76/235 (32%)
Tryp_SPc 51..275 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.