DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prss27

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:260 Identity:87/260 - (33%)
Similarity:133/260 - (51%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDL---KIRVG 86
            |::..|:|||.:......|:|||:||.|:||||||:.:...|:|||||..:  ..|:   ::.:|
  Rat    32 PRMFNRMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTWVLTAAHCFSN--TSDISIYQVLLG 94

  Fly    87 STYWRSGGSVHS----VRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNP--REG 145
            :...:..|. |:    |:..::|..|.......|:|::.::..::|...|..:.:.|.:.  :.|
  Rat    95 ALKLQQPGP-HALYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVCLPDPSVVFKSG 158

  Fly   146 ATAVVSGWGT-TESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYG---------KKIKDTMLCA-Y 199
            ....|:|||: :|......|..|..:.:.:||..:|   ...|.         |.|||.|||| :
  Rat   159 MNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKC---NLLYSKDAEADIQLKTIKDDMLCAGF 220

  Fly   200 AP-HKDACQGDSGGPLVSGDRLV-------GVVSWGYGCGDVRYPGVYADVAHFHEWIERTAEEV 256
            |. .||||:||||||||.   ||       ||:|||.||.....||||..||..::||.:...|:
  Rat   221 AEGKKDACKGDSGGPLVC---LVDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWIHQIIPEL 282

  Fly   257  256
              Rat   283  282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 83/246 (34%)
Tryp_SPc 31..252 CDD:238113 84/248 (34%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 83/246 (34%)
Tryp_SPc 39..278 CDD:238113 84/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.