DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and LOC286960

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:257 Identity:87/257 - (33%)
Similarity:129/257 - (50%) Gaps:20/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIV 66
            :|.::..:.|..|:|..:.|      |.:|||||.......||||||....||.||||:.|...|
  Rat     1 MKISIFFAFLGAAVALPVND------DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWV 59

  Fly    67 ITAAHCLQSIEAKDLKIRVG--STYWRSGGS--VHSVRSFRNHEGYNSRTMVNDIAIIRIESDLS 127
            ::||||.:    :.|::|:|  :.:...||.  :.:.:..| |..||..|:.|||.:|:::|...
  Rat    60 LSAAHCYK----RKLQVRLGEHNIHVLEGGEQFIDAEKIIR-HPEYNKDTLDNDIMLIKLKSPAV 119

  Fly   128 FRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIK 192
            ..|.:..:.:..|.....|..:|||||.|.|.|...|..|..::..::..|.|:.   .|..:|.
  Rat   120 LNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKK---SYPGQIT 181

  Fly   193 DTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERT 252
            ..|.|.  ....||:|.||||||:|....:.|:||||..|.....||||..|.::..||:.|
  Rat   182 SNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQET 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 78/224 (35%)
Tryp_SPc 31..252 CDD:238113 80/226 (35%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 78/224 (35%)
Tryp_SPc 24..243 CDD:238113 80/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.