DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Tpsg1

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:268 Identity:91/268 - (33%)
Similarity:128/268 - (47%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTIPDGLL-----------PQLD---GRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVI 67
            |..||.|.           ||:.   .|||||:.......|:|.||:.:..|.||||:.|.:.|:
Mouse    59 GQYPDSLANSVSSGSGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVL 123

  Fly    68 TAAHCLQ-SIEAKDLKIRVGS---TYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSF 128
            |||||.. |:.:.|.::.:|.   |......:|..:..:....|....:  .|||::::.|.::.
Mouse   124 TAAHCFSGSVNSSDYQVHLGELTVTLSPHFSTVKRIIMYTGSPGPPGSS--GDIALVQLSSPVAL 186

  Fly   129 RSSIREIRI----ADSNPREGATAVVSGWGTTESGGSTIPDH-LLAVDLEIIDVSRCRSDEFG-- 186
            .|.::.:.:    ||..|  |....|:|||.|..|....|.: |....:.::||..| |..:.  
Mouse   187 SSQVQPVCLPEASADFYP--GMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTC-SQAYNSP 248

  Fly   187 YGKKIKDTMLCAYAPHKDACQGDSGGPL---VSGD-RLVGVVSWGYGCGDVRYPGVYADVAHFHE 247
            .|..|:..||||..| .||||.||||||   |:|. :..||||||.|||....|||||.|..:..
Mouse   249 NGSLIQPDMLCARGP-GDACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVN 312

  Fly   248 WIERTAEE 255
            ||.....|
Mouse   313 WIHHHIPE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 82/233 (35%)
Tryp_SPc 31..252 CDD:238113 83/235 (35%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.