DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prss38

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:255 Identity:79/255 - (30%)
Similarity:125/255 - (49%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCL--- 73
            |.:|:|.:..| .|.|.|:::||........|:||||...|.|.|||||.|...|::||||.   
Mouse    38 ANSLSGDVACG-QPVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRG 101

  Fly    74 QSIEAKDLKIRVGS-------TYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSS 131
            :.:|..|:.:.:.:       |.|   ..::.|......:.|:  .:..|:|:::::|.:.|...
Mouse   102 KKLETYDIYVGITNLEKANRHTQW---FEIYQVIIHPTFQMYH--PIGGDVALVQLKSAIVFSDF 161

  Fly   132 IREIRIADSN-PREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTM 195
            :..|.:..|: .....:...:|||.....|.| .:.||...|.:|...:|:. .:|....:...|
Mouse   162 VLPICLPPSDLYLINLSCWTTGWGMISPQGET-GNELLEAQLPLIPRFQCQL-LYGLSSYLLPEM 224

  Fly   196 LCA--YAPHKDACQGDSGGPLVSGDR----LVGVVSWGYGCGDVRYPGVYADVAHFHEWI 249
            |||  ....|:.|:||||.|||....    .:|:||||.||....||||:|:|::|..||
Mouse   225 LCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 70/235 (30%)
Tryp_SPc 31..252 CDD:238113 72/236 (31%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 72/234 (31%)
Tryp_SPc 58..284 CDD:214473 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.