DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prtn3

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:281 Identity:80/281 - (28%)
Similarity:126/281 - (44%) Gaps:69/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LAGTIPD--GLLPQL-----------DGRIVGGYETSIDAHPYQVSLQ--RY-GSHFCGGSIYSH 63
            :||:.|.  |:.|.|           ..:||||:|....:.||..|||  |: |||||||::...
Mouse     1 MAGSYPSPKGIHPFLLLALVVGGAVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHP 65

  Fly    64 DIVITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRS-------------FRNHEGYNSRTMVN 115
            ..|:|||||||.|..:.:.:.:|:         |.:.|             |:|:  ||....:|
Mouse    66 RFVLTAAHCLQDISWQLVTVVLGA---------HDLLSSEPEQQKFTISQVFQNN--YNPEENLN 119

  Fly   116 DIAIIRIESDLSFRSSIREIRIA-----DSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEII 175
            |:.::::....|..   :|:.:|     |....:|...:..|||..   |:..|...:..:|.:.
Mouse   120 DVLLLQLNRTASLG---KEVAVASLPQQDQTLSQGTQCLAMGWGRL---GTQAPTPRVLQELNVT 178

  Fly   176 DVS-RCRSDEFGYGKKIKDTMLCAYAPHKDA--CQGDSGGPLVSGDRLVGVVSWGY-GCGDVRYP 236
            .|: .||...           :|...|.:.|  |.|||||||:....|.||.|:.. .|..:::|
Mouse   179 VVTFLCREHN-----------VCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFP 232

  Fly   237 GVYADVAHFHEWIE---RTAE 254
            ..:|.|:.:.:||:   |.||
Mouse   233 DFFARVSMYVDWIQNVLRGAE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 69/243 (28%)
Tryp_SPc 31..252 CDD:238113 71/248 (29%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 69/243 (28%)
Tryp_SPc 30..248 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.