DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prss1

DIOPT Version :10

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:78 Identity:18/78 - (23%)
Similarity:31/78 - (39%) Gaps:26/78 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GGMLRNASYHSKFEHHELNV--PPPAVLDERHAVKIPYMLLGDKSFLFTEYCIRPFGGHLKPDSP 249
            |..|||::::    :|.|::  |||:.|.....:.                |:..:    |..|.
Mouse   584 GHNLRNSAHY----NHGLDIPSPPPSPLHIEEEID----------------CLEQY----KSTSV 624

  Fly   250 ESTFNYRMSQART 262
            .|:..:..|.|||
Mouse   625 PSSAPHSPSAART 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 12/63 (19%)
Prss1NP_444473.1 Tryp_SPc 24..242 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.