DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and KLK8

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:242 Identity:75/242 - (30%)
Similarity:117/242 - (48%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHC-------------LQSIEAK 79
            :.:::||:|....:.|:|.:|.:.....|||.:...:.|:|||||             ||:.:..
Human    75 EDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGP 139

  Fly    80 DLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMV---NDIAIIRIESDLSFRSSIREIRIADSN 141
            :.:|.|          |.|:    .|..|||..:.   :|:.::::....|..|.::.|.:||..
Human   140 EQEIPV----------VQSI----PHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHC 190

  Fly   142 PREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCA-YAPHKDA 205
            .:.|....||||||..|.....||.|...:::|....:|   |..|..:|.|.|:|| .:...|.
Human   191 TQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKC---EDAYPGQITDGMVCAGSSKGADT 252

  Fly   206 CQGDSGGPLVSGDRLVGVVSWGYG-CGDVRYPGVYADVAHFHEWIER 251
            ||||||||||....|.|:.|||.. ||....||||.::..:.:||::
Human   253 CQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 73/236 (31%)
Tryp_SPc 31..252 CDD:238113 75/239 (31%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 73/236 (31%)
Tryp_SPc 78..300 CDD:238113 75/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.