DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and PRSS21

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:286 Identity:94/286 - (32%)
Similarity:138/286 - (48%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLSVL-------------ACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFC 56
            |:||::|             |..|:|  |.| ...:..|||||.:..:...|:|.||:.:.||.|
Human     6 ALLLALLLARAGLRKPESQEAAPLSG--PCG-RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVC 67

  Fly    57 GGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWR-SGGSVHSVRSFRNHEGYNSRTMVN----- 115
            |.|:.||...:|||||.::.  .||....|   |. ..|.:.|:.||.:.:.|.:|..|:     
Human    68 GVSLLSHRWALTAAHCFETY--SDLSDPSG---WMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLS 127

  Fly   116 ---------DIAIIRIESDLSFRSSIREIRI-ADSNPREGAT-AVVSGWG-TTESGGSTIPDHLL 168
                     |||::::.:.:::...|:.|.: |.:...|..| ..|:||| ..|......|..|.
Human   128 PRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQ 192

  Fly   169 AVDLEIIDVSRCRS--DEFGYGKKIKDTMLCAYAPH--KDACQGDSGGPLVSGDR----LVGVVS 225
            .|.:.||:.|.|..  .::.:.|.|...|:||....  ||||.|||||||.....    .:||||
Human   193 EVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVS 257

  Fly   226 WGYGCGDVRYPGVYADVAHFHEWIER 251
            ||.|||....||||.:::|..|||::
Human   258 WGVGCGRPNRPGVYTNISHHFEWIQK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 83/244 (34%)
Tryp_SPc 31..252 CDD:238113 84/247 (34%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 84/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.