DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and LOC102554637

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:265 Identity:89/265 - (33%)
Similarity:138/265 - (52%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIV 66
            ::..::|.::..|:|..:.|      |.:|||||.....:.||||||.. |.|:||||:.:...|
  Rat     1 MRALLVLVLVGAAVAFPVDD------DDKIVGGYTCQEHSVPYQVSLNS-GYHYCGGSLINDQWV 58

  Fly    67 ITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSV------RSFRN------HEGYNSRTMVNDIAI 119
            ::||||.:|    .:::|:|.         |::      ..|.|      |..::.:|:.|||.:
  Rat    59 VSAAHCYKS----RIQVRLGE---------HNINVLEGDEQFVNAAKIIKHPNFDRKTLNNDIML 110

  Fly   120 IRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDE 184
            |::.|.:...:.:..:.:..|....|...::||||.|.|.|...||.|..:|..::..:.|   |
  Rat   111 IKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNDPDLLQCLDAPLLPQADC---E 172

  Fly   185 FGYGKKIKDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHE 247
            ..|..||.:.|:||  ....||:||||||||:|....|.|:|||||||.....||||..|.::.:
  Rat   173 ASYPGKITNNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVD 237

  Fly   248 WIERT 252
            ||:.|
  Rat   238 WIQDT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 81/232 (35%)
Tryp_SPc 31..252 CDD:238113 83/234 (35%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.