DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and LOC100485189

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:258 Identity:83/258 - (32%)
Similarity:126/258 - (48%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEA 78
            ||.||   .:..:...||:||.|...::.|:..||..:..|.|||.:...:.|:|||||    :.
 Frog     8 ALLGT---AVQARYYDRIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHC----QL 65

  Fly    79 KDLKIRVGSTYWRSGGSVHSVRSFRN------------HEGYNSRTMVNDIAIIRIESDLSFRSS 131
            ..|::|:|.         |::..:..            |.|:|..|..|||.::::.|.::....
 Frog    66 SSLQVRLGE---------HNLAVYEGKEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDY 121

  Fly   132 IREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCR----SDEFGYGKKIK 192
            ::.|.:......:|.|.:|||||||.|...|.||.|..|:::.:....|:    :||      |.
 Frog   122 VQTIPLGCPTVGDGETCLVSGWGTTTSPEETFPDELQCVEVQTVSQDYCQGAFPTDE------IT 180

  Fly   193 DTMLCAYAPH--KDACQGDSGGPLVSGDRLVGVVSWG-YGCGDVRYPGVYADVAHFHEWIERT 252
            |.||||....  ||:||||||||||....:.|:.||| ..||....||:|..:.::..||:.|
 Frog   181 DNMLCAGVMEGGKDSCQGDSGGPLVCNSMVHGITSWGNTPCGVANKPGIYTKICNYIAWIQDT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 76/237 (32%)
Tryp_SPc 31..252 CDD:238113 77/239 (32%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 77/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.