DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and zgc:171509

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:230 Identity:76/230 - (33%)
Similarity:118/230 - (51%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGYETSIDAHPYQVSL-QRYGSHFCGGSIYSHDIVITAAHCLQS-----IEAKDLKIRVGST 88
            :|:||:|....:.|:|..| ..||  .||||:.....|::||||..|     :...||.: |..|
Zfish    20 KIIGGHECQPHSQPWQARLDDGYG--LCGGSLIHESWVVSAAHCKSSSIIVHLGKHDLFV-VEDT 81

  Fly    89 YWRSGGSVHSVRSFR--NHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREGATAVVS 151
                   ...:::.:  :|..||:|...|||.:|::.......::::.:.:..:....|...:||
Zfish    82 -------AQEIQAEKVISHPKYNNREHNNDIMLIKLREPAVINNNVKPVPLPTNCSHAGEQCLVS 139

  Fly   152 GWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCA--YAPHKDACQGDSGGPL 214
            |||.|   |.:|...|..::|.|:..:.|:|   .||:.|...|.||  ....||:||||||||:
Zfish   140 GWGVT---GDSISSTLQCLELPILSKADCKS---AYGRVITKKMFCAGFMDGGKDSCQGDSGGPV 198

  Fly   215 VSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWI 249
            |....|.|:||:|.||.:..:||||.:|..:..||
Zfish   199 VCNGTLKGIVSFGIGCAEPGFPGVYVEVCRYINWI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 74/228 (32%)
Tryp_SPc 31..252 CDD:238113 76/229 (33%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 74/228 (32%)
Tryp_SPc 21..234 CDD:238113 76/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.