DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and zgc:165423

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:256 Identity:94/256 - (36%)
Similarity:132/256 - (51%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQS- 75
            ||   |..|      |:.:||||...|..:.|:|.||...||||||||:.|...:::||||..| 
Zfish    28 AC---GKAP------LNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSN 83

  Fly    76 IEAKDLKIRVGSTYWRSGGSV-------HSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIR 133
            ....|..:.:|    |....:       .||.....|..|...|..||:|::.:.|.::|.:.|:
Zfish    84 PNPSDYTVYLG----RQSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQ 144

  Fly   134 EIRI-ADSNPREGATAVVSGWGTTESGGS-TIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTML 196
            .:.: ||.:.....|..::||||.|||.| ..|..|..|::.|:..:.|.. .:|.|..|.:.|:
Zfish   145 PVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNC-LYGGGSSITNNMM 208

  Fly   197 CA--YAPHKDACQGDSGGPLV--SGDRLV--GVVSWGYGCGDVRYPGVYADVAHFHEWIER 251
            ||  ....||:||||||||:|  |.:..|  ||||:|.||.|..||||||.|:.:..||.:
Zfish   209 CAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 87/234 (37%)
Tryp_SPc 31..252 CDD:238113 89/237 (38%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 87/234 (37%)
Tryp_SPc 38..269 CDD:238113 89/235 (38%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.