DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Gm10334

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:261 Identity:90/261 - (34%)
Similarity:139/261 - (53%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAA 70
            ::|:::..|:|..:.|      |.:|||||....::.||||||.. |.||||||:.:...|::||
Mouse     5 LILALVGAAVAFPVDD------DDKIVGGYTCQENSVPYQVSLNS-GYHFCGGSLINDQWVVSAA 62

  Fly    71 HCLQSIEAKDLKIRVGSTYWRSGGSVHSV------RSFRN------HEGYNSRTMVNDIAIIRIE 123
            ||.::    .:::|:|.         |::      ..|.|      |..:|.:|:.|||.:|::.
Mouse    63 HCYKT----RIQVRLGE---------HNINVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLS 114

  Fly   124 SDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYG 188
            |.::..:.:..:.:..|....|...::||||.|.|.|.:.||.|..:|..::..:.|   |..|.
Mouse   115 SPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADC---EASYP 176

  Fly   189 KKIKDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIER 251
            .||...|:||  ....||:||||||||:|....|.|:|||||||.....||||..|.::.:||:.
Mouse   177 GKITGNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQD 241

  Fly   252 T 252
            |
Mouse   242 T 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 82/232 (35%)
Tryp_SPc 31..252 CDD:238113 84/234 (36%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 84/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.