DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN8 and Cops8

DIOPT Version :9

Sequence 1:NP_723378.2 Gene:CSN8 / 49077 FlyBaseID:FBgn0261437 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_598566.3 Gene:Cops8 / 108679 MGIID:1915363 Length:209 Species:Mus musculus


Alignment Length:200 Identity:54/200 - (27%)
Similarity:92/200 - (46%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSEVVERLENEEFEQVELGA----EVYQQLLAIYLYQNKLADAKLLWMRVPANLRD-DKELIQLN 65
            :.:::::.||:|.|..  |.    .||.||||:||.||.:.:|:.||.|:|..::. :.||..:.
Mouse    13 FRKLLDQCENQELEAP--GGIATPPVYGQLLALYLLQNDMNNARYLWKRIPPAIKSANSELGGIW 75

  Fly    66 LLNIALQNNNYADFFKHIK-YEWSERVKSPVEDLLNKQREELFKLMGSAYMSIYQHNLLELSLMS 129
            .:...:...::...:..|. ::|||.|:..:|.|.:..|...|.|:..||.||...:......:.
Mouse    76 SVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLP 140

  Fly   130 EDELKHACAALNWTEELDGDRVILK----------------PKVQEAP-PARGNDDQLLKLTEFV 177
            .:|.........|..: ...|::|.                |..:.|| |...|:.||.:||::|
Mouse   141 VEEAVKGVLEQGWQAD-STTRMVLPRKPASGTLDVSLNRFIPLSEPAPVPPIPNEQQLARLTDYV 204

  Fly   178 TFLEN 182
            .||||
Mouse   205 AFLEN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN8NP_723378.2 CSN8_PSD8_EIF3K 22..156 CDD:287089 36/155 (23%)
Cops8NP_598566.3 CSN8_PSD8_EIF3K 34..166 CDD:287089 35/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11433
eggNOG 1 0.900 - - E1_KOG4414
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4882
Inparanoid 1 1.050 67 1.000 Inparanoid score I5334
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005676
OrthoInspector 1 1.000 - - oto92428
orthoMCL 1 0.900 - - OOG6_104449
Panther 1 1.100 - - LDO PTHR13339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4524
SonicParanoid 1 1.000 - - X4075
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.