DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mbs and ppp1r27b

DIOPT Version :9

Sequence 1:	NP_001246786.1	Gene:	Mbs / 49070	FlyBaseID:	FBgn0005536	Length:	1273	Species:	Drosophila melanogaster
Sequence 2:	NP_001032181.1	Gene:	ppp1r27b / 559662	ZFINID:	ZDB-GENE-051023-5	Length:	156	Species:	Danio rerio

Alignment Length:	119	Identity:	43/119 - (36%)
Similarity:	61/119 - (51%)	Gaps:	13/119 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    40 RRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANV-------DGLTALHQACIDDNLDMVEF 97
            |.:.|.:..||......|:.:.|      |..|.|..|       .|:.|:|:|.:..|::.|:.
Zfish    27 RIVHFPNDIVFQDCVRQGELERV------GCFIQTRRVSLDTIYHSGMAAIHEAVLSGNMECVKL 85

  Fly    98 LVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDL 151
            ||:.||||.::|.:||||||...|.||..||:|.:..|||..|.|..|:...||
Zfish    86 LVKSGADITQRDEDGWTPLHMACSDGFPEIAKYSISLGADTEAKNDCGEKPADL 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mbs	NP_001246786.1	ANK	50..164	CDD:238125	40/109 (37%)
		Ank_2	53..142	CDD:289560	35/95 (37%)
		ANK repeat	78..109	CDD:293786	12/30 (40%)
		ANK	106..290	CDD:238125	21/46 (46%)
		ANK repeat	111..142	CDD:293786	16/30 (53%)
		ANK repeat	209..239	CDD:293786
		Ank_2	213..300	CDD:289560
		ANK repeat	241..272	CDD:293786
		PRKG1_interact	1177..1272	CDD:292521
ppp1r27b	NP_001032181.1	ANK	40..148	CDD:238125	39/106 (37%)
		Ank_2	40..130	CDD:289560	35/95 (37%)
		ANK repeat	66..97	CDD:293786	12/30 (40%)
		ANK repeat	99..130	CDD:293786	16/30 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910