DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mbs and Nrarp

DIOPT Version :9

Sequence 1:NP_001246786.1 Gene:Mbs / 49070 FlyBaseID:FBgn0005536 Length:1273 Species:Drosophila melanogaster
Sequence 2:NP_001137222.1 Gene:Nrarp / 499745 RGDID:1591939 Length:114 Species:Rattus norvegicus


Alignment Length:88 Identity:33/88 - (37%)
Similarity:49/88 - (55%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VFLAACLSGDKDEVVQLLDQGA----DINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQD 109
            :|..|...|:..|:..||....    ::|:...:|.|||||:.||.||::|:.||:.||||...:
  Rat    17 IFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLAN 81

  Fly   110 NEGWTPLHATASCGFVSIARYLV 132
            .:||:.||..|..|...|..||:
  Rat    82 RDGWSALHIAAFGGHQDIVLYLI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MbsNP_001246786.1 ANK 50..164 CDD:238125 33/87 (38%)
Ank_2 53..142 CDD:289560 32/84 (38%)
ANK repeat 78..109 CDD:293786 17/30 (57%)
ANK 106..290 CDD:238125 9/27 (33%)
ANK repeat 111..142 CDD:293786 9/22 (41%)
ANK repeat 209..239 CDD:293786
Ank_2 213..300 CDD:289560
ANK repeat 241..272 CDD:293786
PRKG1_interact 1177..1272 CDD:292521
NrarpNP_001137222.1 Ank_2 21..106 CDD:403870 32/84 (38%)
ANK repeat 50..81 CDD:293786 17/30 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0505
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.